PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 322aa    MW: 36645.9 Da    PI: 6.7566
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584940.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.7e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++ ++++G g+W++ ++  g++R++k+c++rw +yl
   XP_013584940.1 14 KGPWTPEEDEKLINHIRKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding568.8e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE++ +++++ +lG++ W++I+ +++ gRt++++k++w+++
   XP_013584940.1  67 RGNFTAEEEQTIINLHSLLGNK-WSSISGHLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.892961IPR017930Myb domain
SuperFamilySSF466891.95E-3211108IPR009057Homeodomain-like
SMARTSM007175.6E-161363IPR001005SANT/Myb domain
PfamPF002491.6E-171461IPR001005SANT/Myb domain
CDDcd001671.97E-121661No hitNo description
PROSITE profilePS5129426.85762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2765117IPR009057Homeodomain-like
SMARTSM007175.4E-1666114IPR001005SANT/Myb domain
PfamPF002494.9E-1667111IPR001005SANT/Myb domain
CDDcd001672.63E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDEKLINHIR KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TAEEEQTIIN LHSLLGNKWS SISGHLPGRT DNEIKNYWNT HIRKKLIQMG  120
IDPVTHRPRT DHLNVLAALP QLLAAASFNN LLTLNQNIQP DATSVAKAQW LHSMMQVLNS  180
NNTSSSVDIH HTNYNIFGQS SFLENRPNIS ENLYDPTQSI SRIDHQPLDS FSSPLGVFSH  240
QDNEDMIPPL ISASSDGSKQ TQMMIKNKEI LKHNEHTSNP SSTLTFTQDH QPWCDIIDDE  300
ASDSYWKDLI EQTCSEPWPF HE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29121165108B-MYB
1h8a_C8e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584940.10.0PREDICTED: myb-related protein 330-like
SwissprotQ8GWP02e-78MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D3CN560.0A0A0D3CN56_BRAOL; Uncharacterized protein
STRINGBra032028.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.10.0myb domain protein 107